PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00009354-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family SRS
Protein Properties Length: 439aa    MW: 45100.7 Da    PI: 8.0283
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00009354-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022205.1e-682253853154
              DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklss 93 
                         +gt++CqdCGnqakkdC+h+RCRtCCksrgfdCathvkstWvpaa+rrerq +  +as+ a +s a++ +k++r   ++++++ s+t++s+
  WALNUT_00009354-RA 225 TGTTTCQDCGNQAKKDCSHRRCRTCCKSRGFDCATHVKSTWVPAARRRERQLMGVSASAAAGSSGATSGAKKPRLI-TSQTTTNSHTSTSN 314
                         6899**********************************************99999999999999999999999986.888899999***** PP

              DUF702  94 aeskkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                         ++++++ +tss          lP +v+++avf+cvrv++v+dge+++aYq++v+igGhvfkG+LydqG+e+
  WALNUT_00009354-RA 315 TTPPRSYDTSSshqdvsfkeaLPGQVRAPAVFKCVRVTAVEDGEDQYAYQAVVNIGGHVFKGFLYDQGVES 385
                         ********9999********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.7E-62227384IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016239.4E-27229271IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.8E-30336383IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MTYLMASVVA TTRRLPSDSG AFADWAATSS SAAGRAAPDE LSLGFNAGPT AAGTSTGPTS  60
GMWSAAPSRQ INYGLASTEM GMVGLRDLFV VAPASSFHHN NHHHHHHQHD PIMSDPHSIN  120
GSNPATALGV GVGVGVIPLL TATPCLAPSN IGVDDENNML SNRNRGGGGI QLWQNNQHTQ  180
HGHYFKKPAI LDHGGSGNLV QTVGGGGGGG SGGAGMGGST TTSSTGTTTC QDCGNQAKKD  240
CSHRRCRTCC KSRGFDCATH VKSTWVPAAR RRERQLMGVS ASAAAGSSGA TSGAKKPRLI  300
TSQTTTNSHT STSNTTPPRS YDTSSSHQDV SFKEALPGQV RAPAVFKCVR VTAVEDGEDQ  360
YAYQAVVNIG GHVFKGFLYD QGVESRDGYP NISELHLGGG GDGGRNVVSS SAPILDPSDV  420
YAASGGGLLG GSSFGNPIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651514.11e-177PREDICTED: protein LATERAL ROOT PRIMORDIUM 1, partial
SwissprotQ94CK95e-90LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A061GZE91e-163A0A061GZE9_THECC; Lateral root primordium protein-related isoform 3 (Fragment)
STRINGVIT_06s0009g03450.t011e-155(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.25e-73Lateral root primordium (LRP) protein-related